PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ48165.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family GATA
Protein Properties Length: 1367aa    MW: 140824 Da    PI: 9.4644
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ48165.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA44.91.6e-14563596134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 CsnCgtt+TplWR++ d   t CnaCG+y +++g
  KXZ48165.1 563 CSNCGTTQTPLWRKDRDTGETMCNACGIYKQSHG 596
                 ****************77777********99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004019.1E-13557608IPR000679Zinc finger, GATA-type
PROSITE profilePS5011419.639557614IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.62E-13557609No hitNo description
Gene3DG3DSA:3.30.50.103.6E-18558605IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.57E-18562616No hitNo description
PfamPF003201.2E-12563596IPR000679Zinc finger, GATA-type
PROSITE patternPS003440563588IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1367 aa     Download sequence    Send to blast
MCRPVELIRA SLNHVARRAF GKSDTGSGGG EGSRARTLAA QVTRKSVRKR QASRTRFDHE  60
EEVDGRPHPL SAPVAKFPRL GVTGEGPSPS QQRLLRYGAA GQALPLRLPA GALLGPHANS  120
EALQAAARLV GAVGLMLPFT TAVGGPQHAA GLGLAAQGHY AYLSPSDEDH EAGARADDGA  180
ADDPDDEWVG PPPAHAQRQR AGGGSTADGG EPRGDSDSGE EGPPSPANGD GPPLAVDDDS  240
EAVARILLRM HHCVYSLGPK RLGLDGGDDG AGAVAATTGA AASRDAKGGD AAAMAAATAA  300
QEKLQSLLES EAAAAVRGNH LAYLAALQQA RGMAALQAGA SGQPKAEALE KAKGAAQINV  360
LNLLARLKAQ EAAIAQGQPP GVKEEAARGL VSPEQDSAGA RLPSQDGTAG AVRTQPGPDG  420
RVLLLFPMDG REQLKDAAAG AGGSGGAGQH PPRLVPLPGP GQWTSARPAS TGSVPEYAAR  480
EQASVAQSPT GSAPSAGARG AGDEQRGLAR SSEASGGAGQ GLHAGPRQPF SQHLSGQQSG  540
DTSGRGMPPP PKPPRNHKGP LQCSNCGTTQ TPLWRKDRDT GETMCNACGI YKQSHGFNRP  600
VGGRQSVPQP VVKRFPVARP VGAQPVRSNQ PARPGTVQDA AAPAKPAASA AGGAPLRQLP  660
LAAAAAAALS GSAALGRAGV LAAPGIGGAA EELRAALELL SRGSEVPLGS VASDASARSA  720
TAATSGRSDG LGLGNGAGSS PRRADLQMGQ VGQAAGASSP GPEPGWRPSP RPHAGGSDSS  780
GADFEAAQRS PPHSSYPVTG VAQMVQEQSK AASEDQQESS RQRLPQQQQQ RGLEGADRPA  840
DQQAARKSVG EDGRGSPLHG LLSDALRRQA AEVLGMQQHA QQQLNQQQHQ QQHHLQQQQQ  900
QQQAQQQADA RRREREQREL EAEHDADRDA LRRQHLLQQQ ARVLLQLKAA ESAAAAQLQE  960
HVCGGAAPAA PSAAPHAAGP RGSDGAAAGD STRSSGSAAP AVQRPFRLDL SGAEPPLPSG  1020
TGGGVVGSGG AARASGEQRG RGGARSDEDA GGEDGGVLPY LLARLTQQGQ EFRSAQVQRE  1080
RMLLQQHQQQ QQRQAAQHQQ EQQQLQQQRR ERDEGLAPLA AQQQHINAAE QQLLMMLIKQ  1140
RQQQQQQQQQ HLQQERELAE VQQHLLHRQE QAAAAGSGAG VGGLGGLGGG DHPLTRGNAD  1200
AEARVLGGAE GAPGSPPFAL RQLQRPQSSA AAGPAHHETL PQRQPLAQES HRPQTGPHVH  1260
PLQQQSHHHL PHRSDGARQP QAQSLPQQGQ QPRTQKHVSR SGTVVVTAGS GAAQQRLQQQ  1320
SGQGQGPRAS GQQQQVNDAE ARVLGILRAA GIDLSGLGRA ATAAAGW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GF150.0A0A150GF15_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4830810